PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G46530.2
Common NameARF11, F11C10.34, F13A10.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 514aa    MW: 57689.7 Da    PI: 10.0142
Description auxin response factor 11
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G46530.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.72.2e-2337137198
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                  f+k+lt sd++++g +++ +k+a+e+     + +++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   + +++ l+
  AT2G46530.2  37 FVKILTASDTSTHGGFSVLRKHATEClpsldMTQPTPTQELVARDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--RGETGDLR 132
                  89****************************9666677789************************************************..3489999* PP

                  EEEE- CS
           B3  94 vkvfr 98 
                  v+v+r
  AT2G46530.2 133 VGVRR 137
                  **998 PP

2Auxin_resp95.67.6e-32163242183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  a+ha++t+++F v+Y+Pr   s+F+++v+k++ a+k+ +s+GmR++m+fe+e+s+er ++Gt++g  dl++ +Wp SkWrsL+
  AT2G46530.2 163 ASHAVTTTTIFVVFYKPRI--SQFIISVNKYMMAMKNGFSLGMRYRMRFEGEESPERIFTGTIIGSGDLSS-QWPASKWRSLQ 242
                  689***************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.23E-3922166IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.9E-3731152IPR015300DNA-binding pseudobarrel domain
CDDcd100176.17E-2036137No hitNo description
SMARTSM010192.3E-2137139IPR003340B3 DNA binding domain
PROSITE profilePS5086312.12537139IPR003340B3 DNA binding domain
PfamPF023621.8E-2137137IPR003340B3 DNA binding domain
PfamPF065077.4E-29163242IPR010525Auxin response factor
PfamPF023092.6E-9388439IPR033389AUX/IAA domain
SuperFamilySSF542776.41E-15398479No hitNo description
Gene3DG3DSA:3.10.20.2408.1E-4402477No hitNo description
PROSITE profilePS5174527.948403486IPR000270PB1 domain
PfamPF023097.9E-7449486IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020003anatomyplant ovule
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MRPMRFTLRS HYNQKKIEPT SLDPPLVEPA KPTVDSFVKI LTASDTSTHG GFSVLRKHAT  60
ECLPSLDMTQ PTPTQELVAR DLHGYEWRFK HIFRGQPRRH LLTTGWSTFV TSKRLVAGDA  120
FVFLRGETGD LRVGVRRLAK QQSTMPASVI SSQSMRLGVL ATASHAVTTT TIFVVFYKPR  180
ISQFIISVNK YMMAMKNGFS LGMRYRMRFE GEESPERIFT GTIIGSGDLS SQWPASKWRS  240
LQIQWDEPSS IQRPNKVSPW EIEPFSPSAL TPTPTQQQSK SKRSRPISEI TGSPVASSFL  300
SSFSQSHESN PSVKLLFQDP ATERNSNKSV FSSGLQCKIT EAPVTSSCRL FGFDLTSKPA  360
SATIPHDKQL ISVDSNISDS TTKCQDPNSS NSPKEQKQQT STRSRIKVQM QGTAVGRAVD  420
LTLLRSYDEL IKELEKMFEI EGELSPKDKW AIVFTDDEGD RMLVGDDPWN EFCKMAKKLF  480
IYPSDEVKKM RSKSLLGDKG TIVNLESDQR TVHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldx_B1e-12018266105356Auxin response factor 1
4ldx_A1e-12018266105356Auxin response factor 1
4ldw_B1e-12018266105356Auxin response factor 1
4ldw_A1e-12018266105356Auxin response factor 1
4ldv_A1e-12018266105356Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1487493KKMRSKS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.364970.0flower| silique| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453610650.0
Genevisible265454_at0.0
Expression AtlasAT2G46530-
AtGenExpressAT2G46530-
ATTED-IIAT2G46530-
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G46530.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G46530
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2299240.0AK229924.1 Arabidopsis thaliana mRNA for ARF1 family auxin responsive transcription factor like protein, complete cds, clone: RAFL22-28-H22.
GenBankAY6697910.0AY669791.1 Arabidopsis thaliana clone C105346 ARF11 (At2g46530) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_973701.10.0auxin response factor 11
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLD7LEK50.0D7LEK5_ARALL; Auxin response factor
STRINGAT2G46530.30.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hagen G,Guilfoyle T
    Auxin-responsive gene expression: genes, promoters and regulatory factors.
    Plant Mol. Biol., 2002 Jun-Jul. 49(3-4): p. 373-85
    [PMID:12036261]
  3. Castelli V, et al.
    Whole genome sequence comparisons and "full-length" cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation.
    Genome Res., 2004. 14(3): p. 406-13
    [PMID:14993207]
  4. Cluis CP,Mouchel CF,Hardtke CS
    The Arabidopsis transcription factor HY5 integrates light and hormone signaling pathways.
    Plant J., 2004. 38(2): p. 332-47
    [PMID:15078335]
  5. Remington DL,Vision TJ,Guilfoyle TJ,Reed JW
    Contrasting modes of diversification in the Aux/IAA and ARF gene families.
    Plant Physiol., 2004. 135(3): p. 1738-52
    [PMID:15247399]
  6. Okushima Y, et al.
    Functional genomic analysis of the AUXIN RESPONSE FACTOR gene family members in Arabidopsis thaliana: unique and overlapping functions of ARF7 and ARF19.
    Plant Cell, 2005. 17(2): p. 444-63
    [PMID:15659631]
  7. Coupe SA, et al.
    Systemic signalling of environmental cues in Arabidopsis leaves.
    J. Exp. Bot., 2006. 57(2): p. 329-41
    [PMID:16330523]
  8. Hu W,Ma H
    Characterization of a novel putative zinc finger gene MIF1: involvement in multiple hormonal regulation of Arabidopsis development.
    Plant J., 2006. 45(3): p. 399-422
    [PMID:16412086]
  9. Juenger TE, et al.
    Natural genetic variation in whole-genome expression in Arabidopsis thaliana: the impact of physiological QTL introgression.
    Mol. Ecol., 2006. 15(5): p. 1351-65
    [PMID:16626458]
  10. Song YH, et al.
    DNA-binding study identifies C-box and hybrid C/G-box or C/A-box motifs as high-affinity binding sites for STF1 and LONG HYPOCOTYL5 proteins.
    Plant Physiol., 2008. 146(4): p. 1862-77
    [PMID:18287490]
  11. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  12. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]
  13. Varaud E, et al.
    AUXIN RESPONSE FACTOR8 regulates Arabidopsis petal growth by interacting with the bHLH transcription factor BIGPETALp.
    Plant Cell, 2011. 23(3): p. 973-83
    [PMID:21421811]
  14. Fernandez-Calvino L, et al.
    Arabidopsis plasmodesmal proteome.
    PLoS ONE, 2011. 6(4): p. e18880
    [PMID:21533090]